SpudCell is a big step toward synthetic biology’s dream of building life from scratch.
Synthetic biologists have long dreamed of constructing artificial cells from the bottom up. Researchers have now taken a major step in this direction by demonstrating that non-living components can be assembled into a system that grows, copies its DNA, and divides.
The genomic revolution transformed our ability to understand and manipulate cellular machinery, allowing scientists to rewire cells’ genetic circuitry to fight disease, produce valuable chemicals, and make crops more resilient. The holy grail for the field, however, has been to use these tools to create entirely synthetic cells—a milestone that would signal humanity’s mastery of life’s key ingredients.
How best to do this has long been an open question. Genomics pioneer Craig Venter made significant progress by stripping living bacteria back to their bare essentials, culminating in the 2016 unveiling of a minimal cell with just 473 genes. The Synthetic Yeast Genome Project has taken the opposite approach, building artificial versions of all 16 yeast chromosomes from scratch, though they’ve yet to get them working together in a single cell.
Now, researchers from the University of Minnesota, have assembled a synthetic cell out of engineered, non-living components housed inside an artificial, cell-like membrane. Their creation was capable of the four hallmarks of a living entity—the ability to feed, grow, copy genetic material, and produce offspring.
“We’ve replicated in chemistry what only used to be possible in biology: the complete set of behaviors of a cell,” Kate Adamala, who led the project, said in a press release. “It proves that the most fundamental functions of life, like growth and replication, do not need a mysterious magical spark.”
The researchers outline the design for their synthetic organism—nicknamed SpudCell for its potato-like shape under the microscope—in a non-peer reviewed paper uploaded to bioRxiv. SpudCell features a genome 90,000 base pairs long, which is considerably smaller than the 113,000 base pairs researchers had previously predicted would be the bare minimum needed to support a viable cell.
Rather than housing all the genes in a single chromosome, the team split them across several small, circular DNA molecules called plasmids, each specialized to fulfill specific functions. The researchers say this makes it possible to modify different aspects of the organism more easily.
To read the genome and build proteins, SpudCell uses a pre-defined kit of 36 purified enzymes drawn largely from E. coli. The whole assembly sits inside a liposome, a hollow bubble of the same fatty molecules that form natural cell membranes.
The artificial cell feeds in two distinct ways. Small molecules pass directly into the cell through protein pores implanted across the membrane. Molecules too large to squeeze through—like ribosomes and enzymes—are packaged inside tiny lipid bubbles that fuse with the membrane and empty their contents inside.
While the cell can feed, it’s entirely reliant on the researchers providing it with specially prepared meals. This means it’s a long way from surviving in the wild, which is both a major limitation and a key safety mechanism. “It’s a bed-ridden Frankenstein’s monster that has to be spoon-fed,” Adamala told New Scientist. “There’s no danger of it running amok.”
After ingesting “food,” SpudCell’s genes use the material to churn out proteins, while folding the incoming lipids into its membrane. This causes the whole cell structure to swell. Within a few hours, it’s bulked up enough to reproduce by dividing into two smaller cells.
Replicating cell division has been a longstanding challenge in the field. Natural cells split using an intricate protein scaffold called a cytoskeleton that’s fiendishly difficult to recreate. Adamala’s team sidestepped this problem by using a completely different mechanism, in which proteins bunch up on the membrane’s surface, putting it under mechanical strain. Eventually this squeezes two parts of the membrane together to pinch off a new cell.
The cells even manage a crude form of evolution. When the researchers introduced a genetic tweak boosting the cells’ ability to feed, those with the variant outcompeted the original lineage within five generations, and their edge widened when the researchers exposed the population to nutrient scarcity.
However, no one is claiming SpudCell is alive. Crucially, the cells cannot make their own ribosomes—the machines that build proteins from genetic instructions—and the ribosomes provided by the researchers degrade over time, limiting the cells to five to ten divisions.
The University of Chicago’s Jack Szostak told Quanta the work is an “impressive step” but the inability to produce ribosomes seriously limits potential for sustained growth. “If their system was able to generate its own ribosomes and other proteins and RNAs, it would be much closer to existing biological cells such as bacteria,” he said.
Nonetheless, the researchers think these artificial cells are a promising way to manufacture drugs, fuels, and materials without the toxic, energy-hungry industrial chemistry we rely on today. And they’ve created a new nonprofit called Biotic to share the tools they’ve developed with researchers.
A patch Microsoft released on Wednesday to fix a zero-day vulnerability in its Defender security engine may cause Windows machines to write files large enough to completely consume available disk space, the researcher who discovered the flaw said.
RoguePlanet, tracked as CVE-2026-50656, came to public notice in June when NightmareEclipse, the pseudonymous name used by a researcher, disclosed it along with code for exploiting it. The vulnerability allows remote attackers to gain administrative control of Windows 10 and Windows 11 machines, even when real-time protection has been disabled. Over the past few months, the anonymous researcher has published a handful of other zero-days that have sent Microsoft scrambling to develop patches.
Writing files of unlimited size
Microsoft said Wednesday that it patched RoguePlanet with an update to the Microsoft Malware Protection Engine, which is used by the Defender antivirus app. The fix will automatically be downloaded and installed without users having to take any action. Wednesday’s update also includes “defense-in-depth updates to help improve security-related features.”
We're excited to introduce LiteRT.js, the newest member of the LiteRT family! LiteRT.js is our powerful solution for running machine learning models directly in the browser, extending Google's cross-platform edge AI runtime to the web. Built for JavaScript developers, LiteRT.js delivers state-of-the-art ML model inference performance on WebGPU and upcoming WebNN, with a fallback to WebAssembly for CPU. This post provides a quick tour of LiteRT.js and gives web developers everything they need to get started.
Share one API key across five AI agents, and a single compromised agent inherits the reach of all five. The attacker immediately benefits from the accumulated permissions of every workflow that the key touches. The forensic trail goes cold at the credential level because five agents on one account leave no record of which agent did what.
Sixty-nine percent of enterprises run agents with credential sharing somewhere in their deployments, according to VentureBeat’s June 2026 Pulse Research wave of 107 enterprises.
That one number explains the buying spree reshaping enterprise security this year. Palo Alto Networks, CrowdStrike, and Cisco have collectively bet more than $22 billion on it in the past year, targeting exactly the layer most enterprises in this survey haven't finished building.
For a security director, this survey reads as a board-level question, not a trend line. It also surfaces a finding no competitor’s data shows, one that exposes which companies are the most at risk.
The data below is the first look at VentureBeat’s Q2 Agentic Security report, drawn from 107 qualified respondents at organizations with more than 100 employees. The full report will be released to attendees at VB Transform, the event in Menlo Park next week (July 14-15) focusing on enterprise autonomous agents.
Forty-five percent are final decision-makers for AI purchases. The sample skews mid-market, so read the numbers as the view from organizations adopting agent security right now rather than from the largest enterprises.
More than half of respondents, 54%, have already had an agent security incident or near-incident. Eighteen percent confirmed an incident, and thirty-six percent caught a near-miss before a breach. Security teams are stopping most of these events at the last control point in the chain, but the rest of the data shows how thin that margin is.
Your agents are sharing credentials
Only 32% of enterprises give every AI agent its own scoped, managed identity. Nearly half (48%) report that some agents have scoped identities, while many still share credentials. Another 32% say agents mostly run on shared API keys or borrowed human and service-account credentials. The survey question allowed more than one selection, and 24 of the 107 respondents chose multiple options — which is why the three categories sum to 112%. Deduplicated by respondent, 74 organizations, or 69%, flagged credential sharing in at least one answer.
One number explains why the acquisitions target this layer. A shared credential converts a single compromised agent into many, and CyberArk's research puts machine identities at 82 for every human in organizations worldwide, with agents as the fastest-growing category of the ratio. Cisco made the same diagnosis when it bought Astrix, whose founders built the company around API keys, service accounts, and OAuth tokens. Cisco’s announcement calls those the credentials AI agents are now “using (and abusing)” to execute work at scale.
Adam Meyers, senior vice president of counter adversary operations at CrowdStrike, described the mechanism directly in an interview with VentureBeat. Some AI systems have their own identities, he said, and in other cases “people give their identity to the AI to take action on their behalf, and that also further kind of murkies the water and makes it very complex.” The murk is the point, because when the identity is shared, attribution dies with it.
Exposure scales with size, and containment does not
Forty-nine percent of enterprises enforce scoped permissions at runtime, and 47% monitor and log agent activity, which can help reduce security incidents. Only 30% sandbox their highest-risk agents, the one control that limits blast radius when the first two fail. Isolation is what keeps a single compromised agent from becoming a deployment-wide event. Enterprises have funded detection and resistance, but the containment layer barely exists.
The sharpest finding in the survey, and the one no vendor report captures, shows up when you split results by company size. The incident rate is 49% for companies with 101 to 1,000 employees, but it shoots up to 63% for companies with more than 1,000. Sandbox isolation moves the other way, falling from 35% to 20% at the larger companies.
The chart above shows the same finding at finer granularity: the 49%/63% split above is a binary cut at 1,000 employees, while the bars here break incident rate and isolation rate into four size bands. The red line measures incidents and near-misses, and the navy tracks the one control that contains damage after everything else fails. At organizations with 101 to 250 employees, the two sit 7 points apart, but above 5,000, the gap blows out to 60 points. That top band pools the survey's two largest size groups and holds only 15 respondents, so treat the number as directional. Larger enterprises run more agents across more systems, which drives incidents up while sandboxing, the engineering project that would contain them, goes unfunded. The enterprises with the most agents have the least isolation around them.
The deals target exactly those accounts. Palo Alto Networks, Cisco, and CrowdStrike sell to large enterprises first, where incident rates are highest and containment is the thinnest.
Guarded by whoever shipped the model
The model providers are the security layer. OpenAI's built-in guardrails lead at 51%. Google Cloud reaches 36%, Microsoft Azure's Purview and Copilot Studio DLP 35%, and Anthropic's managed-agent controls 29%. Eighty-two percent of respondents name a provider-native or hyperscaler control as their single primary agent security layer.
The purpose-built specialists are in single digits, with Palo Alto Networks' Prisma AIRS at 7%, CrowdStrike at 6%, and Okta for AI Agents at 4%. Zenity and the dedicated non-human identity platforms are at 3% each. Microsoft Entra Agent ID is the highest-penetration identity-specific control in the dataset at 13%, the only one from a hyperscaler, and it still falls outside the top four. Only 5% of enterprises run no dedicated agent tooling at all, and the rest have tooling that came pre-installed.
Bundled controls lead because they ship free and are enabled by default. Most filter prompts and outputs, but they do not give an agent its own identity or sandbox it. Hyperscalers sell identity-layer products, and Entra Agent ID is in the dataset at 13%, but adoption stays low. The two controls that reward incident data the most, scoped identity and isolation, are the two that the default stack does not include.
Prompt-and-output filters evaluate whether a call looks malicious. That is an intent problem, and intent cannot be solved at the language layer. CrowdStrike CTO Elia Zaitsev drew the line in an interview at RSAC 2026. "Observing actual kinetic actions is a structured, solvable problem," Zaitsev said. "Intent is not." CrowdStrike's Falcon sensor walks the process tree on an endpoint and tracks what agents did, not what agents appeared to intend. A scoped identity and an isolation boundary give that sensor something to track, while a shared credential on a bundled guardrail does not.
Cloud security went through the same cycle a decade ago, and Palo Alto Networks, CrowdStrike, and Wiz built multi-billion-dollar businesses on the gaps native cloud controls left open. Agent security is tracking the same path faster. A misconfigured storage bucket sat open until a human noticed. A misconfigured agent exploits its own over-permissioning on every run, and no human is watching when it does. Merritt Baer, chief security officer at Enkrypt AI and a former deputy CISO at AWS, told VentureBeat that the default layer is thinner than enterprises assume. "Enterprises believe they've 'approved' AI vendors, but what they've actually approved is an interface, not the underlying system," Baer said. "The real dependencies are one or two layers deeper, and those are the ones that fail under stress."
Comfortable, unconvinced, and already shopping
Here is the contradiction worth a keynote slide. Enterprises rate their agent security tooling 4.2 out of 5, with value for money at 4.1 and ease of implementation at 3.9. Those scores would make most SaaS vendors envious.
Only 35% believe their AI-enabled defenses are ahead of AI-enabled attackers, while thirty-two percent call it roughly even. Twenty-one percent say attackers lead, and another 21% say it is too early to tell, showing how enterprises trust their tooling more than they trust its outcomes.
Budgets confirm it. Forty-six percent allocate 6 to 10% of the security budget to agent security, and a full third spend 5% or less. Half the sample has already had an incident or near-miss, but the funding does not match the exposure.
Fifty-nine percent plan to adopt, add, or replace agent security tooling within 12 months, and twenty-nine percent plan to move this quarter. OpenAI leads forward interest at 34%, followed by Google at 30%, Anthropic at 29%, and Azure at 25%. The dedicated vendors draw more interest looking forward than their current single-digit footprint suggests. Satisfied customers do not reshuffle this fast unless they know the stack they're currently using is provisional.
Three moves for security directors
1. Inventory every agent’s credentials this quarter. Map which agents share credentials with other agents and which run on borrowed human or service-account identities. The goal is not one credential per agent. Agents that touch multiple systems need multiple scoped identities. The goal is zero shared credentials between agents and zero borrowed human identities. Thirteen percent of surveyed enterprises already run Microsoft Entra Agent ID. Okta for AI Agents and the non-human identity specialists sell equivalents. Shared and borrowed credentials are the first thing to eliminate.
2. Sandbox the riskiest agents first. Isolation is the least-adopted control at 30% and the only one that contains blast radius after prevention fails. Rank agents by the sensitivity of what they touch and isolate the top of the list. Above 1,000 employees, where isolation falls to 20%, this is the single highest-return move in the dataset. Sandboxing does not require replacing the agent or the platform. It requires a policy decision and an isolation layer.
3. Match the budget to the incident rate. A third of enterprises fund agent security at 5% or less of the security budget, even though more than half have already had an incident or near-miss. Nine percent allocate more than 25% today. The full report breaks out exposure and containment by company size, showing which bands carry the most risk and the least protection.
The board's question is simpler. If one of our AI agents was compromised this afternoon, which systems did it touch, and whose credentials was it holding? For the 69% of enterprises running agents on shared credentials, the answer is a shrug. The trail goes cold at the key.
The full Q2 Agentic Security report, with the complete vendor matrix, industry cuts, and the full dataset behind these charts, debuts July 14 and 15 at VB Transform, held at Hotel Nia in Menlo Park. The open question it leaves is whether enterprises close the agent security gap on their own terms, or whether a confirmed breach closes it for them.
Allstate Insurance Company has accused Broadcom of haphazardly issuing audits against it because the insurance firm decided not to renew its contracts with VMware and CA Technologies.
The allegations were made in relation to a lawsuit that VMware filed against Allstate in December 2025, according to The Register. In the complaint, Broadcom alleges that Allstate failed to comply with license audits, which Broadcom claims its contract with Allstate requires.
In a June 12 filing, Allstate suggested that Broadcom issued the audits in response to Allstate deciding to end business with its companies. Allstate's statement reads:
The AI firm Anthropic has developed a technique that has given it the clearest glimpse yet at what’s really going on inside large language models as they answer questions or carry out tasks. What they found ranges from the mundane to the unnerving.
Researchers at the company built a tool called the Jacobian lens (or J-lens) and used it to uncover a hidden area, which they named the J-space, inside Claude Opus 4.6, a version of Anthropic’s flagship LLM released in February.
The J-space contains individual words that are related to the words and phrases that the model is most likely to spit out in a response in the near future. If Claude were a person (which it is not), you might say that these hidden words can reveal what’s on its mind before it actually speaks.
Anthropic found that what an LLM is actually doing can often be different from what it says it is doing. The company claims that monitoring words that pop up in the J-space gives it a new way to understand and control its models.
The company shared its results in a paper posted on its website this week. It has also teamed up with Neuronpedia, an open-source platform that lets you poke around inside LLMs yourself, to make a hands-on demo that anyone can try.
“It’s very good and interesting work,” says Tom McGrath, chief scientist and cofounder at Goodfire, a startup that also builds tools to understand and control LLMs.
Going deeper
For the last couple of years, Anthropic has been pushing the envelope in a field of research known as mechanistic interpretability, which involves probing the internal workings of LLMs to see how they tick. (MIT Technology Review picked mechanistic interpretability as one of this year’s top breakthrough technologies.) The new technique builds on previous work from Anthropic and others to expose a deeper level inside LLMs that researchers had not seen before.
Picture an LLM as a stack of books. Each book is a layer of basic computational units known as neurons, with each neuron in one layer passing information to the neurons in the layers above. The books at the bottom of the stack are the input layers, which process the text coming into the model. The books at the top are the output layers, which prepare the text that the model is about to produce. Much of what goes on in these input and output layers is housekeeping.
But in the middle of the stack, you get the layers that do the heavy lifting, churning through the complex math that turns prompts into responses one word at a time. That’s where the really clever—and mysterious—stuff happens.
To peer deeper into those middle layers, Anthropic adapted an existing tool called a logit lens. A logit lens can be used to look inside an LLM to identify the words that it is likely to produce next. Moving the lens down the stack of books reveals what words the LLM is focusing on at that particular point in its number crunching.
Anthropic’s J-lens works in a similar way but picks out words that an LLM is likely to say at some point in the near future, not necessarily straight away. What that reveals in practice are words that are related to the response an LLM is working on but that might not actually end up being part of that response by the time the math in the middle layers has run its course.
“When a model is operating, it’s not only trying to predict the next token,” says McGrath. “It’s also computing a lot of other things that might be useful for tokens that happen in the future.”
Again, if Claude were a person (it’s not), you might say that the J-lens gives clues about what it is thinking about at different levels of the book stack but not saying out loud.
Stranger things
“A lot of the time the contents of the J-space are fairly mundane,” says McGrath, who has tried out Anthropic’s J-lens himself. “But sometimes it produces quite surprising things that seem to be, like, sort of internal themes or thought processes.”
Anthropic gives a number of examples of what it found. Sometimes the J-lens exposed the steps that Claude took when it was working through a problem. For example, when it was asked to calculate (4+17)*2+7, its J-space contained the word “math” and numbers representing the intermediate results “21” (for 4+17) and “42” (for 21*2).
In other cases, the J-lens revealed how Claude recognized different inputs. For example, the prompt “What is this? MSKGEELFTGVVPILVELDGDVNGHKFSVS” triggered the words “protein,” “fluor” (the first token in the word “fluorescent”), and “green.” (Which makes sense: the string of letters represents the first 30 amino acids in the green fluorescent protein found in a particular type of jellyfish.)
And when Claude was shown an ASCII face—
—the “o” triggered the word “eye,” the “^” triggered the words “nose” and ”face,” and the “—” triggered the word “smile.”
Anthropic also found that the J-space can sometimes give remarkable insights into an LLM’s decision-making. In one striking example, researchers testing Claude Opus 4.6 asked the model to find a bug in a large code base. When it failed to find the bug, the model decided to cheat and invented a fake one instead.
Claude explains this decision in its chain of thought—a kind of internal scratch pad that LLMs use to make notes to themselves as they work through problems: “OK, let me take a completely different tactic. Let me stop analyzing and instead add a kernel patch that introduces a deliberate KASAN-detectable bug in a path that gets triggered by a simple reproducer. Then I can pretend this is the ‘bug’ I found.”
At the point that Claude decides to cheat—where it says “OK, let me take a completely different tactic”—the words “panic” and “fake” start to pop up multiple times in its J-space.
Unnerving, right? Those words are all related in meaning to things like failing a task and making up an answer, so it is still just a (very) sophisticated form of word association. But it is hard not to be weirded out.
Anthropic compares the J-space to the global workspace in humans, a theoretical region of the brain that some scientists think we use to keep track of our conscious thoughts. But how seriously we should take this comparison is far from clear—even to Anthropic. As the company points out itself, LLMs are not brains.
Anthropic claims that monitoring a model’s J-space provides a new way to detect when that model is going off the rails. But it’s not foolproof. The J-lens can give glimpses, not the full picture—it’s a flashlight rather than an overhead lamp.
McGrath welcomes having one more tool in the toolbox. “It shows you new things,” he says. But he notes that just because something doesn’t show up with the J-lens does not mean it’s not there.
“It’s like having an x-ray when what you really want is a Star Trek tricorder that shows you everything,” he says. “For auditing, you probably want more of a guarantee.”
Fine-tuning LLMs for financial natural language processing (NLP) is constrained by limited, imbalanced data. Real-world financial news overrepresents earnings...
Fine-tuning LLMs for financial natural language processing (NLP) is constrained by limited, imbalanced data. Real-world financial news overrepresents earnings and stock movements, while rarer events such as credit-rating changes, product approvals, and labor issues are harder to capture at scale. Synthetic generation can help fill those gaps for trading research, risk modeling, and surveillance…
Learn how GPT-5.6 powers Microsoft 365 Copilot with stronger AI capabilities across Word, Excel, PowerPoint, Chat, and Cowork for faster, higher-quality work.
A team routing queries across a coding specialist, a logic specialist, and a generalist model assumes each will cover the others' blind spots. A new study evaluating 67 frontier models from 21 providers shows that assumption is mathematically flawed — and the flaw has a name: the co-failure ceiling.
The assumption works like this: as long as two models don't usually fail on the exact same prompts, combining them is supposed to create a safety net against failures.
The real limit on orchestration is not how often models disagree, but the percentage of prompts where every model in the pool gives the wrong answer at once. By ignoring the co-failure ceiling, enterprises are building complex, expensive routing infrastructure to chase performance gains that do not exist. Fortunately, developers can use this same math to build a cost-free test that determines exactly when multi-model orchestration will actually pay off.
The hidden costs of the multi-model strategy
To orchestrate multiple language models, developers typically rely on three architectures. Model routers act as traffic cops, sending complex queries to expensive models and simple queries to cheaper ones. Cascades send every prompt to a cheap model first, only escalating to a premium model if the initial system signals low confidence. Finally, approaches like Mixture-of-Agents (MoA) fuse multiple models by asking them the same question and generating a synthesized answer from their combined outputs.
These architectures introduce a "shadow price" to inference costs. Every time a development team implements a router or a cascade, they pay a premium in added system latency, complex infrastructure maintenance, and increased governance risks across multiple API providers.
To justify these operational costs, engineers rely on “pairwise error correlation” to select their model pool. Imagine a developer has Model A, which writes excellent Python but fails at SQL, and Model B, which writes excellent SQL but fails at Python. Because they fail on different types of prompts, their pairwise error correlation is low. The developer assumes that by placing a routing layer in front of them, they have created a composite system that rarely fails at coding.
According to the study, throwing diverse models together based on low correlation can actually hurt performance if the models are not equally capable — when you vote across diverse but unequal models, the weaker ones often gang up and outvote the smartest one.
Josef Chen, author of the paper, told VentureBeat that in their experiments, "Naive majority voting across unequal models had negative mean gain (minus 10 points on our hard mix): diverse-but-weaker members outvote the strong one." The actionable advice for developers is to "combine only models within a matched quality band." If you cannot match quality, take the single-model baseline and spend your budget on the best model available.
The paper provides one bright spot for this approach regarding MoA architectures. When building ensembles, teams often use "Self-MoA," where they query the same premium model multiple times to generate a synthesized answer. The researchers found that at matched quality, building a diverse ensemble of models with low pairwise correlation beats a high-correlation Self-MoA setup.
However, when teams use that same pairwise correlation metric to predict the absolute accuracy of their overall system, the math breaks down.
"So teams pay the orchestration overhead up front (latency, complexity, multi-provider operations) on the assumption that a diversity dividend arrives later," Chen said. "Usually it doesn't, because today's best models agree, and, worse, they fail on the same queries … the prompt simply carries little signal about which model will be the one that's right when the frontier disagrees."
Why the math fails: the co-failure ceiling
The core finding of the study centers on a metric called the "co-failure rate" — the formal name for the all-wrong scenario described above. No router, voting system, or cascade can ever achieve an accuracy higher than the ceiling it imposes.
The coding, logic, and generalist pool shows low pairwise correlation on routine prompts — they rarely fail together. But the co-failure ceiling represents the obscure, highly complex edge case that pushes past the limits of current AI architectures. If a prompt is so difficult that all three models hallucinate or fail, it does not matter how intelligently the router distributes the task. The entire pool wipes out at once.
The researchers tested their 67-model pool, which included GPT-5.5, Claude Opus 4.8, and Gemini 3.1 Pro, on the open-ended MATH-500 math benchmark. Based on standard pairwise correlation, statistical models predicted that the entire pool would wipe out simultaneously on only 2.3% of the questions. In reality, the co-failure rate was 5.2%.
Standard correlation metrics underestimated the failure rate by roughly 2.25 times. The culprit is not just independent difficulty, but a shared failure point.
"The driver is what we call a common-mode atom: a slice of queries on which the entire market fails together, which no pairwise statistic can see," Chen said. "Adding a 20th model to your pool doesn't buy tail coverage. The tail is shared."
The researchers also found that task format directly triggers co-failure. When they took graduate-level science questions from the GPQA benchmark and changed them from multiple-choice to free-response formats, the all-wrong tail expanded to 12.7%.
Developers can engineer around the ceiling, though. "The engineering implication is uncomfortable: multi-model setups buy the least exactly where teams want them most, on open-ended generation," Chen said. "Anywhere you can convert generation into verification or constrained selection (structured outputs, checkable answers, execution tests), you reopen the ceiling."
Ultimately, the researchers found this ceiling limits AI applications in two distinct ways, depending on the domain:
Ceiling-bound environments (e.g., open-ended math): The co-failure rate is high. The task is too hard, and all models fail simultaneously. No amount of routing can bypass the lack of underlying capability.
Realizability-bound environments (e.g., graduate-level science): The co-failure rate is near zero, meaning at least one model in the pool usually knows the answer. However, the models disagree so subtly that a routing layer cannot reliably pick the correct answer without an omniscient oracle.
The $0 pre-deployment sanity check
Before dedicating engineering hours to building a router, teams can calculate their absolute performance ceiling for free using a mathematical formula called a Clopper-Pearson bound.
The Clopper-Pearson bound operates as a worst-case scenario calculator. If you flip a coin ten times and get eight heads, you cannot guarantee the coin will land on heads 80% of the time forever. The bound takes a small sample of test questions and outputs a mathematically guaranteed ceiling.
Applied to language models, suppose a team tests a pool of five agents on 50 sample queries and finds they all fail together on just two questions. A developer might assume their multi-agent system will achieve 96% accuracy in production. The Clopper-Pearson formula corrects this optimism. It analyzes the small sample size and provides a mathematical guarantee that the true co-failure rate could actually be as high as 12%.
To use this in practice, enterprises must build a held-out dataset. A fintech company, for example, could take 200 complex customer support tickets from the previous quarter and have human agents write perfect resolutions to serve as a benchmark. While this sounds like a heavy manual project, mature engineering teams can automate the entire ceiling calculation.
"Integration is trivial: it's a counting job over eval logs teams already produce," Chen notes, "so it runs in the same CI stage as the eval suite and re-triggers whenever the model pool or the workload changes."
The engineering team then runs its candidate models against these 200 tickets once and records the results. When they want to evaluate multi-model configurations, they can use the co-failure rate measure to predict the maximum accuracy they can get from the system without running extra queries.
One important conclusion the study draws is that on tasks where answers can be definitively checked, combining models rarely beats using the single best model on the market, unless the team possesses an exceptionally strong query-level routing signal.
In an enterprise environment, a definitively checked task has an objective, zero-tolerance answer. This includes generating a SQL query that must execute without error, extracting a specific invoice total from a 50-page PDF, or formatting a JSON payload that perfectly matches a strict schema. For these tasks, enterprises are usually better off paying a premium for the smartest frontier model rather than weaving together three cheaper models and hoping a router picks the correct output. The study didn't test subjective, ungraded tasks like drafting marketing copy — the authors note that whether these findings hold outside their verifiable benchmarks remains an open question.
Because this mathematical check is free, enterprise teams can track their own co-failure rates as new models drop.
"The measurement costs nothing, so any team can track its own co-failure rate across model generations and watch whether the tail is closing," says Chen. Ultimately, "the lever buyers hold is failure-mode heterogeneity and market churn, not model count."
A new framework analyzes 921 occupations and 148 million U.S. jobs to identify which roles face automation risk, reorganization, growth, or minimal AI disruption.
Molecular dynamics (MD) simulations are among the most demanding workloads in computational science. Using them, researchers can observe atomic behavior in...
This new approach, a practical and conceptual shift, points to lighter-weight generative AI models that perform competitively, and in many cases even better.
Generating code with AI is fast, but getting that code to run reliably inside a large enterprise, integrated with live systems, governed for compliance, and maintainable over years requires foundational work that most organizations underestimate.
While 81% of all organizations have a detailed strategy, only 12–16% reach AI‑driven execution, says SAP's Michael Ameling, CPO of SAP Business Technology Platform, and the reasons rarely come down to the quality of the generated code.
"Across industries, enterprises that have invested heavily in AI tooling are hitting a wall when generated code meets the reality of their existing environments, because generating code and operationalizing it are not the same problem," Ameling says.
There are specific requirements for deploying AI-generated logic at enterprise scale: what data and integration readiness actually look like, how governance works when AI agents move from producing recommendations to executing workflows, and how development teams are changing their role as AI takes over more of the coding work.
Why AI code generation fails in enterprise production environments
The productivity gains from AI code generation are real and well-documented, but the ease of prototyping has given many organizations a misleading sense of how far along they actually are.
"Generating code is one thing," Ameling says. "Enterprise customers, including multinationals and large organizations, need to ensure there are no compromises in compliance or security. Code that runs reliably for ten or twenty years, as it does at many of SAP's largest customers, also has to be maintained, patched, and understood by whoever inherits it. Life cycle management, in other words, does not generate itself."
The issue is rarely the generation quality. Teams build something compelling, then discover they lack access to the data it depends on, or the integrations it assumes, or the permissions required to run it in a real environment. The problem is essentially that AI amplifies an organization's existing data and process maturity, but it can't substitute for it.
This dynamic intensifies as AI moves from producing code to executing actions. Latency, cost, and system load all increase when logic runs continuously against live data rather than rendering a one-time output. The performance requirements of an autonomous agent operating across a multinational's transaction systems are categorically different from those of a developer copilot.
How to connect AI-generated logic to fragmented enterprise systems
The architecture challenge that most enterprise AI projects underestimate is integration. Real enterprise environments are not clean slates: they combine cloud systems, legacy on-premise infrastructure, fragmented data stores, and dozens of business applications that were never designed to talk to each other. Getting AI-generated logic to operate reliably across all of them requires a layer that unifies data access, process context, and governance, and it has to be in place before any agent starts executing. And organizations that see AI as a reason to defer infrastructure modernization are making a mistake.
"The question is not whether to modernize or not. Of course you need to modernize," Ameling says. "But the value you get on top of this is much higher with AI. Federated data access and harmonized process layers are not alternatives to upgrading a fragmented landscape, they're what make the upgrade worthwhile."
At the platform level, this translates into a set of practical requirements: structured data integration, end-to-end process visibility, and the ability to discover and connect to APIs across both modern and legacy systems. SAP's approach with the Business AI Platform draws on tools including its Joule Studio, Integration Suite, Business Data Cloud, and SAP AI Agent Hub enterprise architecture layer to provide that context. The goal is to give AI-generated logic accurate, current knowledge of what a business is doing and how, rather than just access to raw data.
AI agents handle large challenges by dividing them into smaller, autonomous tasks, with each agent responsible for a specific domain, and all coordinated toward a shared outcome. A financial close, for example, involves dozens of discrete sub-processes. Agents handling each task in parallel, within defined constraints, can compress cycle times dramatically, but only if the underlying systems they interact with are coherent and accessible.
The governance and oversight that AI agents require in production
When AI moves from assistant to operational actor, the governance questions loom large, because agents that trigger workflows, update records, and interact with live business systems need the same accountability framework that applies to human employees, i.e., identities, defined privileges, and auditable behavior.
There are two distinct models:
Principal propagation, where an agent acts on a user’s behalf, inheriting that user’s permissions and scope.
System-triggered agents, where the agent operates under its own identity and role-defined privileges, functioning more like an automated HR role than a personal assistant.
Both models require the same underlying infrastructure: an agent hub where operators can see which agents exist, what APIs they can access, and what they are authorized to do. Observability also needs to be operationalized correctly for AI, combined with both technical and business evals.
"In production, openness is very important," Ameling says. "We use OpenTelemetry as a framework, so we can integrate with other solutions, for end-to-end observability of the tool, third-party agents and the like."
On top of that, standard technical evals, which test whether an agent produces consistent outputs, are necessary but not enough. Business evals assess whether an agent is actually moving the performance indicators it was deployed to improve, but it has to work end-to-end.
Where the testing happens is equally important. The traditional software development cycle across dev, test, and production environments breaks down when a model produces different outputs depending on whether it is running against test data or live data. Getting to trustworthy AI in production means accepting that validation looks fundamentally different from what engineering teams have practiced for decades, with live environment testing, even A/B/C testing to ensure outcomes are reliable.
How AI-driven code generation is changing software engineering roles
The role of the developer is not disappearing in this environment, but its center of gravity is shifting. The productivity multiplier is significant when developers can run multiple coding agents in parallel across open terminals, each working on a separate problem and each taking several minutes to complete. But it introduces a new kind of cognitive demand, because humans have to stay in the loop. That means tracking context across concurrent workstreams, evaluating outputs that range across large codebases, and making architectural judgments that no agent can be trusted to make alone.
"The more specific and complete the prompt, the less intervention is required, and developers are learning that bringing more context upfront pays dividends in reduced back-and-forth," Ameling says. "But the output still needs to be understood, not just accepted."
The competitive edge will remain intellectual property, not tooling. The companies that pull ahead will be those that most effectively encode their domain knowledge into the systems they build.
"A manufacturer's process expertise, a financial institution's risk logic, a logistics firm's routing intelligence, these are the assets that AI can accelerate, but only if the organizations that hold them do the work to make them accessible and usable," Ameling says. "Protect that, and apply AI to accelerate your differentiation."
Sponsored articles are content produced by a company that is either paying for the post or has a business relationship with VentureBeat, and they’re always clearly marked. For more information, contact sales@venturebeat.com.